Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q83RD1

Expression Region

1-109

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVVYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CERD4 (DPF3) Rabbit Polyclonal Antibody
TA369958 100 µL

CERD4 (DPF3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uridine Diphosphate Choline Ammonium Salt
TRC-U829930-1MG 1 mg

Uridine Diphosphate Choline Ammonium Salt

Sign In for Pricing
View Details
KITH Antibody
8C10270-AAT 50 µg

KITH Antibody

Sign In for Pricing
View Details
CD34 Rabbit Polyclonal Antibody
TA367770 100 µL

CD34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cd24a Rat Monoclonal Antibody [Clone ID: 91]
AM08034FC-N 500 µg

Cd24a Rat Monoclonal Antibody [Clone ID: 91]

Sign In for Pricing
View Details
Recombinant Mouse Cst3 Protein (Trx Tag)
PDEM100128-01 20 µg

Recombinant Mouse Cst3 Protein (Trx Tag)

Sign In for Pricing
View Details