Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q83RD1

Expression Region

1-109

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVVYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NKAP activation kit by CRISPRa
GA112466 1 Kit

Human NKAP activation kit by CRISPRa

Sign In for Pricing
View Details
Human KCTD14 activation kit by CRISPRa
GA112270 1 Kit

Human KCTD14 activation kit by CRISPRa

Sign In for Pricing
View Details
Histone H4 (acetyl K8) Recombinant Rabbit Monoclonal Antibody [PS01-25]
HA721249 100 µL

Histone H4 (acetyl K8) Recombinant Rabbit Monoclonal Antibody [PS01-25]

Sign In for Pricing
View Details
PEPD (NM_001166056) Human Over-expression Lysate
LC431394 20 µg

PEPD (NM_001166056) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit
RD-ALOXE3-Hu-01 96 Tests

Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit

Sign In for Pricing
View Details
Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit
RD-ALOXE3-Hu-02 48 Tests

Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit

Sign In for Pricing
View Details