Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q8XG16

Expression Region

1-109

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPC6-AS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
22456061 1.0 µg DNA

GPC6-AS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TAF4 Polyclonal Antibody
MBS7142212 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TAF4 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Nol12 (NM_133800) AAV Particle
MR202432A1V 250 µL

Mouse Nol12 (NM_133800) AAV Particle

Sign In for Pricing
View Details
RPS19BP1 Blocking Peptide
CBP4216-01 1 mg

RPS19BP1 Blocking Peptide

Sign In for Pricing
View Details
RPS19BP1 Blocking Peptide
CBP4216-02 5 mg

RPS19BP1 Blocking Peptide

Sign In for Pricing
View Details
N4BP2L2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G7]
TA804199BM 100 µL

N4BP2L2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G7]

Sign In for Pricing
View Details