Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q8XG16

Expression Region

1-109

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken CCRL1 (Chemokine C-C-Motif Receptor Like Protein 1) ELISA Kit
MBS2514291-01 24 Tests

Chicken CCRL1 (Chemokine C-C-Motif Receptor Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken CCRL1 (Chemokine C-C-Motif Receptor Like Protein 1) ELISA Kit
MBS2514291-02 48 Test

Chicken CCRL1 (Chemokine C-C-Motif Receptor Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken CCRL1 (Chemokine C-C-Motif Receptor Like Protein 1) ELISA Kit
MBS2514291-03 96 Tests

Chicken CCRL1 (Chemokine C-C-Motif Receptor Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken CCRL1 (Chemokine C-C-Motif Receptor Like Protein 1) ELISA Kit
MBS2514291-04 5x 96 Tests

Chicken CCRL1 (Chemokine C-C-Motif Receptor Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken CCRL1 (Chemokine C-C-Motif Receptor Like Protein 1) ELISA Kit
MBS2514291-05 10x 96 Tests

Chicken CCRL1 (Chemokine C-C-Motif Receptor Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
C7orf63, NT (C7orf63, Uncharacterized protein C7orf63) (MaxLight 490) discontinued
033056-ML490 100 µL

C7orf63, NT (C7orf63, Uncharacterized protein C7orf63) (MaxLight 490) discontinued

Sign In for Pricing
View Details