Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

P69211

Expression Region

1-109

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTF2 Rabbit Polyclonal Antibody
55110-01 50 µL

MTF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTF2 Rabbit Polyclonal Antibody
55110-02 100 µL

MTF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRP63 Polyclonal Antibody, FITC Conjugated
bs-13764R-FITC 100 µL

MRP63 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
CA101 Antibody - N-terminal region (ARP55699_P050)
ARP55699_P050 100 µL

CA101 Antibody - N-terminal region (ARP55699_P050)

Sign In for Pricing
View Details
Rabbit SMC1 IHC Antibody
orb1518808-01 10 µL

Rabbit SMC1 IHC Antibody

Sign In for Pricing
View Details
Rabbit SMC1 IHC Antibody
orb1518808-02 100 µL

Rabbit SMC1 IHC Antibody

Sign In for Pricing
View Details