Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

P69211

Expression Region

1-109

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ID3 (Inhibitor of DNA Binding 3, Dominant Negative Helix-loop-Helix Protein, HEIR-1, bHLHb25) (Biotin)
247373-Biotin 100 µL

ID3 (Inhibitor of DNA Binding 3, Dominant Negative Helix-loop-Helix Protein, HEIR-1, bHLHb25) (Biotin)

Sign In for Pricing
View Details
APC anti-human CD61
E16FHA061-025 25 Tests

APC anti-human CD61

Sign In for Pricing
View Details
Human PCNXL3 shRNA Plasmid
abx968065-01 150 µg

Human PCNXL3 shRNA Plasmid

Sign In for Pricing
View Details
Human PCNXL3 shRNA Plasmid
abx968065-02 300 µg

Human PCNXL3 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Cytochrome c oxidase subunit 6B2 (COX6B2) ELISA Kit
GTR10321040 96 Well

Rabbit Cytochrome c oxidase subunit 6B2 (COX6B2) ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For Xylosyltransferase 1
E11585d 96 Tests

ELISA Kit For Xylosyltransferase 1

Sign In for Pricing
View Details