Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Quaternary ammonium compound-resistance protein qacE (qacE)

This Recombinant Quaternary ammonium compound-resistance protein qacE (qacE) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

Quaternary ammonium compound-resistance protein qacE, Quaternary ammonium determinant E

UniProt

P0AGC9

Expression Region

1-110

Origin

Escherichia coli

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIVSGVVVLNLLSKASAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 / BSAP (Early B-Cell Marker) (PAX5/2595), CF594 conjugate, 0.1mg/mL
BNC942595-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PAX5/2595), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1R (light chain, Cleaved-Ile464) Antibody
8L0230-AAT 50 µg

C1R (light chain, Cleaved-Ile464) Antibody

Sign In for Pricing
View Details
DAP Kinase 2 (DAPK2) (N-term) Rabbit Polyclonal Antibody
AP13896PU-N 400 µL

DAP Kinase 2 (DAPK2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PIP5K3 (PIKFYVE) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
CF810375 100 µg

PIP5K3 (PIKFYVE) Mouse Monoclonal Antibody [Clone ID: OTI1A5]

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF647 conjugate, 0.1mg/mL
BNC472445-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Crotyl Alcohol (cis/trans Mixture)
TRC-C818820-50G 50 g

Crotyl Alcohol (cis/trans Mixture)

Sign In for Pricing
View Details