Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oligotropha carboxidovorans UPF0060 membrane protein OCAR_5428/OCA5_c25530 (OCAR_5428, OCA5_c25530)

This Recombinant Oligotropha carboxidovorans UPF0060 membrane protein OCAR_5428/OCA5_c25530 (OCAR_5428, OCA5_c25530) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

UPF0060 membrane protein OCAR_5428/OCA5_c25530

UniProt

B6JBL9

Expression Region

1-110

Origin

Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLAAFVGAALMEIGGCFAFWAWLRLGQSPLWLIPGMAALALFAYLLTLVDSPLAGRAY AAYGGIYIASALVWGWAMEGHRPDRWDVAGATICLIGMAVILFGPRPAAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-500 1x 500 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-500 1x 500 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF594 conjugate, 0.1mg/mL
BNC942151-100 1x 100 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (8D6), CF405S conjugate, 0.1mg/mL
BNC040424-500 1x 500 µL

CD147 (8D6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details