Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas syringae pv. phaseolicola UPF0060 membrane protein PSPPH_1503 (PSPPH_1503)

This Recombinant Pseudomonas syringae pv. phaseolicola UPF0060 membrane protein PSPPH_1503 (PSPPH_1503) spans the amino acid sequence from region 1-110.

Product Specifications

Product Name Alternative

UPF0060 membrane protein PSPPH_1503

UniProt

Q48LG7

Expression Region

1-110

Origin

Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNYLWFFLAALFEIFGCYAFWLWLRQGKSALWVIPALISLTLFALLLTRVEAAYAGRAY AAYGGIYIVASIAWLGLVERVRPLGTDWLGLAFCVIGATIILLGPRWSAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-100 1x 100 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/2782), CF405S conjugate, 0.1mg/mL
BNC042782-100 1x 100 µL

Calbindin 1 (CALB1) (CALB1/2782), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details