Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yvdS (yvdS)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yvdS (yvdS) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yvdS

UniProt

O32262

Expression Region

1-111

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWVLVFIAGLLEVVWASSLKHADSLLDWIIIFILIAVSFILLIRSYQKIPMAAAYTVFV GIGTVGTYLTGIVLGESFSAAQMFFLALLLAGILGMKLFTKESKSQPGGEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELP4 Mouse Monoclonal Antibody [Clone ID: OTI4E2]
CF809149 100 µg

ELP4 Mouse Monoclonal Antibody [Clone ID: OTI4E2]

Sign In for Pricing
View Details
Fibrillin 1 (FBN1) Rabbit Polyclonal Antibody
AP06122PU-N 100 µg

Fibrillin 1 (FBN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Thrombopoietin Recombinant Rabbit monoclonal Antibody
HA725118 100 µL

Human Thrombopoietin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
2,2',3,4,4',5'-Hexabromodiphenyl Ether
TRC-H290735-250MG 250 mg

2,2',3,4,4',5'-Hexabromodiphenyl Ether

Sign In for Pricing
View Details
Gastrin Releasing Peptide (GRP) (NM_002091) Human Over-expression Lysate
LC419540 20 µg

Gastrin Releasing Peptide (GRP) (NM_002091) Human Over-expression Lysate

Sign In for Pricing
View Details
Equine Matrix Metalloproteinase 3 (MMP3) ELISA Kit
RDR-MMP3-Eq-01 96 Tests

Equine Matrix Metalloproteinase 3 (MMP3) ELISA Kit

Sign In for Pricing
View Details