Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 14C (TMEM14C)

This Recombinant Human Transmembrane protein 14C (TMEM14C) spans the amino acid sequence from region 2-112.

Product Specifications

Product Name Alternative

Transmembrane protein 14C

UniProt

Q9P0S9

Expression Region

2-112

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QDTGSVVPLHWFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRN VWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTND4P30 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV735226 1.0 µg DNA

MTND4P30 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
FGFR1OP2 AAV Vector (Rat) (CMV)
20518106 1 µg

FGFR1OP2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
CHD1L (NM_004284) Human Recombinant Protein
TP323499L 1 mg

CHD1L (NM_004284) Human Recombinant Protein

Sign In for Pricing
View Details
NF-κB Signaling Compound Library
L5500-100uL/well 100 μL/Well

NF-κB Signaling Compound Library

Sign In for Pricing
View Details
ADAP1 discontinued
385409 200 µL

ADAP1 discontinued

Sign In for Pricing
View Details
HEPACAM2 Peptide
MBS154158-01 0.05 mg

HEPACAM2 Peptide

Sign In for Pricing
View Details