Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 14C (TMEM14C)

This Recombinant Human Transmembrane protein 14C (TMEM14C) spans the amino acid sequence from region 2-112.

Product Specifications

Product Name Alternative

Transmembrane protein 14C

UniProt

Q9P0S9

Expression Region

2-112

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QDTGSVVPLHWFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRN VWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gmpr2 Pre-designed siRNA Set B
SI105606B 1 Each

Mouse Gmpr2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
LDH-D (F-4)
sc-373989 200 µg/mL

LDH-D (F-4)

Sign In for Pricing
View Details
TCP1 epsilon (CCT5) mouse monoclonal antibody, clone 4E5-4B1, Purified
AM31096PU-N 50 µg

TCP1 epsilon (CCT5) mouse monoclonal antibody, clone 4E5-4B1, Purified

Sign In for Pricing
View Details
Mouse Gja5 Pre-designed siRNA Set A
SI105443A 1 Each

Mouse Gja5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Pfdn4 sgRNA CRISPR Lentivector set (Mouse)
K4762701 3x 1.0 µg

Pfdn4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Hamster Tripartite Motif-Containing Protein 69 (TRIM69) ELISA Kit
MBS9943169-01 48 Well

Hamster Tripartite Motif-Containing Protein 69 (TRIM69) ELISA Kit

Sign In for Pricing
View Details