Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 14C (TMEM14C)

This Recombinant Human Transmembrane protein 14C (TMEM14C) spans the amino acid sequence from region 2-112.

Product Specifications

Product Name Alternative

Transmembrane protein 14C

UniProt

Q9P0S9

Expression Region

2-112

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QDTGSVVPLHWFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRN VWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propyl 2-acetamido-2-deoxy-b-D-glucopyranoside
GC5796-1g 1 g

Propyl 2-acetamido-2-deoxy-b-D-glucopyranoside

Sign In for Pricing
View Details
Transmembrane protein 79 (TMEM79) Bovine ELISA Kit
H8611 96 Tests

Transmembrane protein 79 (TMEM79) Bovine ELISA Kit

Sign In for Pricing
View Details
Mouse mmu-miR-7072-5p miRNA Antagomir
abx889451-01 10 nmol

Mouse mmu-miR-7072-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-7072-5p miRNA Antagomir
abx889451-02 20 nmol

Mouse mmu-miR-7072-5p miRNA Antagomir

Sign In for Pricing
View Details
KCNH2 (Potassium Voltage-Gated Channel subfamily H Member 2, ERG1, HERG, LQT2, SQT1, HERG1, Kv11.1) (MaxLight 550)
MBS6423643-01 0.1 mL

KCNH2 (Potassium Voltage-Gated Channel subfamily H Member 2, ERG1, HERG, LQT2, SQT1, HERG1, Kv11.1) (MaxLight 550)

Sign In for Pricing
View Details
KCNH2 (Potassium Voltage-Gated Channel subfamily H Member 2, ERG1, HERG, LQT2, SQT1, HERG1, Kv11.1) (MaxLight 550)
MBS6423643-02 5x 0.1 mL

KCNH2 (Potassium Voltage-Gated Channel subfamily H Member 2, ERG1, HERG, LQT2, SQT1, HERG1, Kv11.1) (MaxLight 550)

Sign In for Pricing
View Details