Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ydbL (ydbL)

This Recombinant Bacillus subtilis Uncharacterized protein ydbL (ydbL) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Uncharacterized protein ydbL

UniProt

P96607

Expression Region

1-111

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNFITALPIVLLLGFSFVSFMFQFEHLVYFRLALGLFSLVGLYMIYKMKTGIRYFIIYL YASWIVLAAVTAFEEPIFSSFFFGGLVMTMGYLTYMLIYLGMKQDRDANPV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Slit Homolog 3 (Slit3)
RPU43848-01 50 µg

Recombinant Rat Slit Homolog 3 (Slit3)

Sign In for Pricing
View Details
Recombinant Rat Slit Homolog 3 (Slit3)
RPU43848-02 100 µg

Recombinant Rat Slit Homolog 3 (Slit3)

Sign In for Pricing
View Details
Recombinant Rat Slit Homolog 3 (Slit3)
RPU43848-03 1 mg

Recombinant Rat Slit Homolog 3 (Slit3)

Sign In for Pricing
View Details
Rabbit Polyclonal Vasohibin Antibody [HRP]
NBP1-76579H 0.1 mL

Rabbit Polyclonal Vasohibin Antibody [HRP]

Sign In for Pricing
View Details
Her2 Biosimilar Antibody
orb2670009-01 50 µg

Her2 Biosimilar Antibody

Sign In for Pricing
View Details
Her2 Biosimilar Antibody
orb2670009-02 100 µg

Her2 Biosimilar Antibody

Sign In for Pricing
View Details