Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ydbL (ydbL)

This Recombinant Bacillus subtilis Uncharacterized protein ydbL (ydbL) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Uncharacterized protein ydbL

UniProt

P96607

Expression Region

1-111

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNFITALPIVLLLGFSFVSFMFQFEHLVYFRLALGLFSLVGLYMIYKMKTGIRYFIIYL YASWIVLAAVTAFEEPIFSSFFFGGLVMTMGYLTYMLIYLGMKQDRDANPV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3110007F17Rik CRISPR Activation Plasmid (m2)
sc-428488-ACT-2 20 µg

3110007F17Rik CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
µ-Proteofection Kit VI AB
K040-0.25 1 Each

µ-Proteofection Kit VI AB

Sign In for Pricing
View Details
1,3-Dinitrobenzene-15N2
sc-287251 100 mg

1,3-Dinitrobenzene-15N2

Sign In for Pricing
View Details
PLXNB2 3'UTR Lenti-reporter-Luc Vector
37049081 1.0 µg

PLXNB2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Anti-IMPA2
orb1132988 100 µg

Anti-IMPA2

Sign In for Pricing
View Details
ROR2 Human shRNA Plasmid Kit (Locus ID 4920)
TL320439 1 Kit

ROR2 Human shRNA Plasmid Kit (Locus ID 4920)

Sign In for Pricing
View Details