Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ydbL (ydbL)

This Recombinant Bacillus subtilis Uncharacterized protein ydbL (ydbL) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Uncharacterized protein ydbL

UniProt

P96607

Expression Region

1-111

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNFITALPIVLLLGFSFVSFMFQFEHLVYFRLALGLFSLVGLYMIYKMKTGIRYFIIYL YASWIVLAAVTAFEEPIFSSFFFGGLVMTMGYLTYMLIYLGMKQDRDANPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORC4L (ORC4) (NM_181741) Human Over-expression Lysate
LY405645 100 µg

ORC4L (ORC4) (NM_181741) Human Over-expression Lysate

Sign In for Pricing
View Details
DNASE1L3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
18430124 3x 1.0µg DNA

DNASE1L3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
ZNF891 Antibody
orb1240917 100 µL

ZNF891 Antibody

Sign In for Pricing
View Details
Alpha 4 (B-5) Alexa Fluor® 546
sc-373719 AF546 200 µg/mL

Alpha 4 (B-5) Alexa Fluor® 546

Sign In for Pricing
View Details
SRRM4 CRISPR/Cas9 KO Plasmid (m)
sc-427242 20 µg

SRRM4 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
MAGEA3 Antibody
MBS9411000-01 0.1 mL

MAGEA3 Antibody

Sign In for Pricing
View Details