Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Multidrug resistance protein ykkC (ykkC)

This Recombinant Bacillus subtilis Multidrug resistance protein ykkC (ykkC) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

Multidrug resistance protein ykkC

UniProt

P49856

Expression Region

1-112

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWGLVVLAAVFEVVWVIGLKHADSALTWSGTAIGIIFSFYLLMKATHSLPVGTVYAVFT GLGTAGTVLSEIVLFHEPVGWPKLLLIGVLLIGVIGLKLVTQDETEEKGGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-500 1x 500 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-100 1x 100 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF647 conjugate, 0.1mg/mL
BNC472488-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details