Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter sp. UPF0060 membrane protein Arth_4238 (Arth_4238)

This Recombinant Arthrobacter sp. UPF0060 membrane protein Arth_4238 (Arth_4238) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

UPF0060 membrane protein Arth_4238

UniProt

A0AWV9

Expression Region

1-112

Origin

Arthrobacter sp. (strain FB24)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAKTILLFVLAAAAEIGGAWLVWQAVREGKEWWWAGLGVLALGVYGFAATLQPDAHFG RILAAYGGVFVAGSLAWGMVFDGFRPDRWDIIGSVICLLGVAVIMFAPRNAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhox2f sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3068707 1.0 µg DNA

Rhox2f sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Purified Anti-Human CD45 Antibody[HI30]
RD30605F-01 25 µg

Purified Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Purified Anti-Human CD45 Antibody[HI30]
RD30605F-02 100 µg

Purified Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Irs4 (mouse aa633-647) Immunizing Peptide
orb66472 100 µg

Irs4 (mouse aa633-647) Immunizing Peptide

Sign In for Pricing
View Details
Bpifb2 (NM_025631) Mouse Untagged Clone
MC216312 10 µg

Bpifb2 (NM_025631) Mouse Untagged Clone

Sign In for Pricing
View Details
1-Fluoro-2- (2-iodoethynyl) benzene
PC1009482-01 250 mg

1-Fluoro-2- (2-iodoethynyl) benzene

Sign In for Pricing
View Details