Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter sp. UPF0060 membrane protein Arth_4238 (Arth_4238)

This Recombinant Arthrobacter sp. UPF0060 membrane protein Arth_4238 (Arth_4238) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

UPF0060 membrane protein Arth_4238

UniProt

A0AWV9

Expression Region

1-112

Origin

Arthrobacter sp. (strain FB24)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAKTILLFVLAAAAEIGGAWLVWQAVREGKEWWWAGLGVLALGVYGFAATLQPDAHFG RILAAYGGVFVAGSLAWGMVFDGFRPDRWDIIGSVICLLGVAVIMFAPRNAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITM2B 293 Cell Lysate
405894 0.1 mg

ITM2B 293 Cell Lysate

Sign In for Pricing
View Details
Caspase-3
AP81376 1 mg

Caspase-3

Sign In for Pricing
View Details
Recombinant Mouse Follistatin-Like 1/FSTL1 (C-6His)
32-8723-10 10 µg

Recombinant Mouse Follistatin-Like 1/FSTL1 (C-6His)

Sign In for Pricing
View Details
APOH Antibody, FITC conjugated
MBS7104539-01 0.05 mg

APOH Antibody, FITC conjugated

Sign In for Pricing
View Details
APOH Antibody, FITC conjugated
MBS7104539-02 0.1 mg

APOH Antibody, FITC conjugated

Sign In for Pricing
View Details
APOH Antibody, FITC conjugated
MBS7104539-03 5x 0.1 mg

APOH Antibody, FITC conjugated

Sign In for Pricing
View Details