Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clavibacter michiganensis subsp. michiganensis UPF0060 membrane protein CMM_0279 (CMM_0279)

This Recombinant Clavibacter michiganensis subsp. michiganensis UPF0060 membrane protein CMM_0279 (CMM_0279) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

UPF0060 membrane protein CMM_0279

UniProt

A5CML5

Expression Region

1-112

Origin

Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLRTVILFALAAVAEIGGAWLVWQAVREGRPWWWAGLGVMALGAYGFIASLQADASFGR ILAAYGGVFVAGSLVWGAVVDGYRPDRWDVIGAVVCLLGVAVIMFGPRGQGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-500 1x 500 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
BNC400177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF405S conjugate, 0.1mg/mL
BNC040183-500 1x 500 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details