Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 14C (Tmem14c)

This Recombinant Mouse Transmembrane protein 14C (Tmem14c) spans the amino acid sequence from region 2-114.

Product Specifications

Product Name Alternative

Transmembrane protein 14C

UniProt

Q9CQN6

Expression Region

2-114

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QKDSGPLMPLHYFGFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPR NVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVAKVGISLLSSPHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAB1 Antibody
orb520034-01 50 μL

GAB1 Antibody

Sign In for Pricing
View Details
GAB1 Antibody
orb520034-02 100 µL

GAB1 Antibody

Sign In for Pricing
View Details
SLPI, ID (SLPI, WAP4, WFDC4, Antileukoproteinase, BLPI, HUSI-1, Mucus proteinase inhibitor, Protease inhibitor WAP4, Secretory leukocyte protease inhibitor, Seminal proteinase inhibitor, WAP four-disulfide core domain protein 4)
MBS642103-01 0.2 mL

SLPI, ID (SLPI, WAP4, WFDC4, Antileukoproteinase, BLPI, HUSI-1, Mucus proteinase inhibitor, Protease inhibitor WAP4, Secretory leukocyte protease inhibitor, Seminal proteinase inhibitor, WAP four-disulfide core domain protein 4)

Sign In for Pricing
View Details
SLPI, ID (SLPI, WAP4, WFDC4, Antileukoproteinase, BLPI, HUSI-1, Mucus proteinase inhibitor, Protease inhibitor WAP4, Secretory leukocyte protease inhibitor, Seminal proteinase inhibitor, WAP four-disulfide core domain protein 4)
MBS642103-02 5x 0.2 mL

SLPI, ID (SLPI, WAP4, WFDC4, Antileukoproteinase, BLPI, HUSI-1, Mucus proteinase inhibitor, Protease inhibitor WAP4, Secretory leukocyte protease inhibitor, Seminal proteinase inhibitor, WAP four-disulfide core domain protein 4)

Sign In for Pricing
View Details
Fatostatin Hydrobromide 500mg
A16121-500 500 mg

Fatostatin Hydrobromide 500mg

Sign In for Pricing
View Details
Rabbit Monoclonal FOXL2 Antibody (FOXL2/8362R) [PE]
NBP3-20966PE 0.1 mL

Rabbit Monoclonal FOXL2 Antibody (FOXL2/8362R) [PE]

Sign In for Pricing
View Details