Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 14C (Tmem14c)

This Recombinant Mouse Transmembrane protein 14C (Tmem14c) spans the amino acid sequence from region 2-114.

Product Specifications

Product Name Alternative

Transmembrane protein 14C

UniProt

Q9CQN6

Expression Region

2-114

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QKDSGPLMPLHYFGFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPR NVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVAKVGISLLSSPHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GRB7 Antibody Picoband®
A02528 100 µg/Vial

Anti-GRB7 Antibody Picoband®

Sign In for Pricing
View Details
Human STAT1 Recombinant Protein
PROTP42224-10ug 10 µg

Human STAT1 Recombinant Protein

Sign In for Pricing
View Details
RPL17P44 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV777113 1.0 µg DNA

RPL17P44 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Defensin HNP-1 (human)
H-9855.0500 0.5mg

Defensin HNP-1 (human)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human FNDC5 (Fibronectin type III domain containing 5) Full Length
MPC3893K Each

Magic™ Membrane Protein Human FNDC5 (Fibronectin type III domain containing 5) Full Length

Sign In for Pricing
View Details
IGFBP-3 Protein, Human, Recombinant (C-His)
E51P00051 100 µg

IGFBP-3 Protein, Human, Recombinant (C-His)

Sign In for Pricing
View Details