Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Mitochondrial inner membrane protein OXA1L (OXA1L)

This Recombinant Bovine Mitochondrial inner membrane protein OXA1L (OXA1L) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane protein OXA1L, Oxidase assembly 1-like protein, OXA1-like protein

UniProt

Q3SYV3

Expression Region

1-113

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALALMCGRRQLLCLLRPQRQFHSVAGPCQWPRKPLTAGLGFPADRCLGHPRYVLLMAPG PRGLSTSAVSFGEAQVPAPPVIPATPPPTAVPEVASGEAADVIQAAAEQSFAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-100 1x 100 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF568 conjugate, 0.1mg/mL
BNC682290-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF594 conjugate, 0.1mg/mL
BNC942309-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (HPCA1/763), CF640R conjugate, 0.1mg/mL
BNC400763-500 1x 500 µL

CD34 (HPCA1/763), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details