Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Inner membrane protein yiaB (yiaB)

This Recombinant Escherichia coli Inner membrane protein yiaB (yiaB) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Inner membrane protein yiaB

UniProt

P11286

Expression Region

1-113

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTSKTVAKLLFVVGALVYLVGLWISCPLLSGKGYFLGVLMTATFGNYAYLRAEKLGQLD DFFTHICQLVALITIGLLFIGVLNAPINTYEMVIYPIAFFVCLFGQMRLFRSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
BNC940630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-500 1x 500 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details