Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 14D (TMEM14D)

This Recombinant Human Transmembrane protein 14D (TMEM14D) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Transmembrane protein 14D

UniProt

A8MWL7

Expression Region

1-114

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGRAPSLAAGLLFGSLAGVGAYQLYQDP RNVWDFLAATSVTFVGIMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DFNB44 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV722835 1.0 µg DNA

DFNB44 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Monkey Tenascin X (TNX) ELISA Kit
abx359639 96 Well

Monkey Tenascin X (TNX) ELISA Kit

Sign In for Pricing
View Details
Mouse TP53BP2 siRNA
abx937791-01 15 nmol

Mouse TP53BP2 siRNA

Sign In for Pricing
View Details
Mouse TP53BP2 siRNA
abx937791-02 30 nmol

Mouse TP53BP2 siRNA

Sign In for Pricing
View Details
Recombinant Human Semaphorin-7A Protein, His, Yeast-10ug
QP9385-ye-10ug 10ug

Recombinant Human Semaphorin-7A Protein, His, Yeast-10ug

Sign In for Pricing
View Details
Srsf1 Mouse shRNA Plasmid (Locus ID 110809)
TR511952 1 Kit

Srsf1 Mouse shRNA Plasmid (Locus ID 110809)

Sign In for Pricing
View Details