Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 14D (TMEM14D)

This Recombinant Human Transmembrane protein 14D (TMEM14D) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Transmembrane protein 14D

UniProt

A8MWL7

Expression Region

1-114

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGRAPSLAAGLLFGSLAGVGAYQLYQDP RNVWDFLAATSVTFVGIMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRED2 (Sprouty-related, EVH1 Domain-containing Protein 2, Spred-2) (AP) discontinued
029615-AP 100 µL

SPRED2 (Sprouty-related, EVH1 Domain-containing Protein 2, Spred-2) (AP) discontinued

Sign In for Pricing
View Details
Zbtb8b (NM_153541) Mouse Tagged ORF Clone Lentiviral Particle
MR207751L4V 200 µL

Zbtb8b (NM_153541) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TDRD3 sgRNA CRISPR Lentivector set (Human)
K2354601 3x 1.0 µg

TDRD3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
16alpha-Hydroxyandrostenedione
TRC-H790105-250MG 250 mg

16alpha-Hydroxyandrostenedione

Sign In for Pricing
View Details
Rabbit Monoclonal CD68/SR-D1 Antibody (2449C) [CoraFluor 1]
FAB10114CL1 0.1 mL

Rabbit Monoclonal CD68/SR-D1 Antibody (2449C) [CoraFluor 1]

Sign In for Pricing
View Details
CTSD Recombinant Protein
OPCD02530-50UG 50 µg

CTSD Recombinant Protein

Sign In for Pricing
View Details