Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative ethidium bromide resistance protein (ebr)

This Recombinant Putative ethidium bromide resistance protein (ebr) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Putative ethidium bromide resistance protein, E1 protein

UniProt

P0AA23

Expression Region

1-115

Origin

Salmonella typhimurium

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISCA2, ID (ISCA2, HBLD1, Iron-sulfur cluster assembly 2 homolog, mitochondrial, HESB-like domain-containing protein 1) (MaxLight 405)
MBS6311020-01 0.1 mL

ISCA2, ID (ISCA2, HBLD1, Iron-sulfur cluster assembly 2 homolog, mitochondrial, HESB-like domain-containing protein 1) (MaxLight 405)

Sign In for Pricing
View Details
ISCA2, ID (ISCA2, HBLD1, Iron-sulfur cluster assembly 2 homolog, mitochondrial, HESB-like domain-containing protein 1) (MaxLight 405)
MBS6311020-02 5x 0.1 mL

ISCA2, ID (ISCA2, HBLD1, Iron-sulfur cluster assembly 2 homolog, mitochondrial, HESB-like domain-containing protein 1) (MaxLight 405)

Sign In for Pricing
View Details
Cytokeratin 18 Antibody
V7110-20UG 20 µg

Cytokeratin 18 Antibody

Sign In for Pricing
View Details
c-erbB2, p185 (HER2, neu Receptor) (BSA & Azide Free)
MBS6466281-01 0.1 mL

c-erbB2, p185 (HER2, neu Receptor) (BSA & Azide Free)

Sign In for Pricing
View Details
c-erbB2, p185 (HER2, neu Receptor) (BSA & Azide Free)
MBS6466281-02 5x 0.1 mL

c-erbB2, p185 (HER2, neu Receptor) (BSA & Azide Free)

Sign In for Pricing
View Details
Recombinant S100B Antibody / Rabbit Monoclonal
orb2640143 100 µg

Recombinant S100B Antibody / Rabbit Monoclonal

Sign In for Pricing
View Details