Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative ethidium bromide resistance protein (ebr)

This Recombinant Putative ethidium bromide resistance protein (ebr) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Putative ethidium bromide resistance protein, E1 protein

UniProt

P0AA24

Expression Region

1-115

Origin

Pseudomonas aeruginosa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-human ERG (Jackson Foundation patent Anti-ERG Biosimilar)
BIO0599SM-1mg 1 mg

Anti-human ERG (Jackson Foundation patent Anti-ERG Biosimilar)

Sign In for Pricing
View Details
MALT1 (Mucosa-associated Lymphoid Tissue Lymphoma Translocation Gene 1, Mucosa-associated Lymphoid Tissue Lymphoma Translocation Protein 1, MLT1, Caspase-like Protein, DKFZp434L132, MALT-associated Translocation, MALT Lymphoma-associated Translocation, MLT, Paracaspase) (APC) discontinued
M2148-02-APC 100 µL

MALT1 (Mucosa-associated Lymphoid Tissue Lymphoma Translocation Gene 1, Mucosa-associated Lymphoid Tissue Lymphoma Translocation Protein 1, MLT1, Caspase-like Protein, DKFZp434L132, MALT-associated Translocation, MALT Lymphoma-associated Translocation, MLT, Paracaspase) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Leptospira Biflexa rplN protein (aa 1-130)
VAng-Wyb0167-500gEcoli 500 µg (E. coli)

Recombinant Leptospira Biflexa rplN protein (aa 1-130)

Sign In for Pricing
View Details
Hnrnpa3 Rat siRNA Oligo Duplex (Locus ID 362152)
SR500030 1 Kit

Hnrnpa3 Rat siRNA Oligo Duplex (Locus ID 362152)

Sign In for Pricing
View Details
RALGPS1 Antibody
GWB-MP150F 50 µg

RALGPS1 Antibody

Sign In for Pricing
View Details
SREBP1 Rabbit Polyclonal Antibody (BF405)
orb2518799 100 µL

SREBP1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details