Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative ethidium bromide resistance protein (ebr)

This Recombinant Putative ethidium bromide resistance protein (ebr) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Putative ethidium bromide resistance protein, E1 protein

UniProt

P0AA24

Expression Region

1-115

Origin

Pseudomonas aeruginosa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CILP Rabbit Polyclonal Antibody (HRP)
orb471507 100 µL

CILP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Crystallin-AlphaB Polyclonal Antibody
ABP53834-01 30 µL

Crystallin-AlphaB Polyclonal Antibody

Sign In for Pricing
View Details
Crystallin-AlphaB Polyclonal Antibody
ABP53834-02 100 µL

Crystallin-AlphaB Polyclonal Antibody

Sign In for Pricing
View Details
Crystallin-AlphaB Polyclonal Antibody
ABP53834-03 200 µL

Crystallin-AlphaB Polyclonal Antibody

Sign In for Pricing
View Details
Anti-OXSR1 Antibody
MBS821783-01 0.03 mL

Anti-OXSR1 Antibody

Sign In for Pricing
View Details
Anti-OXSR1 Antibody
MBS821783-02 0.05 mL

Anti-OXSR1 Antibody

Sign In for Pricing
View Details