Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

P61383

Expression Region

1-117

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFDINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Mouse IgG, Fc Specific
AAF-441-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Mouse IgG, Fc Specific

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF405S conjugate, 0.1mg/mL
BNC042137-100 1x 100 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3025), CF405S conjugate, 0.1mg/mL
BNC043025-100 1x 100 µL

Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3025), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit
E-EL-H2077-01 24 Tests

Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit

Sign In for Pricing
View Details
Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit
E-EL-H2077-02 48 Tests

Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit

Sign In for Pricing
View Details
Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit
E-EL-H2077-03 96 Tests

Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit

Sign In for Pricing
View Details