Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

P61383

Expression Region

1-117

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFDINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5 Anti-Mouse CD161/NK1.1 Antibody
RD20041F-01 25 µg

PE/Cyanine5 Anti-Mouse CD161/NK1.1 Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD161/NK1.1 Antibody
RD20041F-02 100 µg

PE/Cyanine5 Anti-Mouse CD161/NK1.1 Antibody

Sign In for Pricing
View Details
GPR17 (NM_001161415) Human Over-expression Lysate
LC431323 20 µg

GPR17 (NM_001161415) Human Over-expression Lysate

Sign In for Pricing
View Details
Helixyte™ iFluor® 594 Nucleic Acid Labeling Dye *Optimized for Labeling 100-300 ug DNA/RNA*
17960-AAT 1 mg

Helixyte™ iFluor® 594 Nucleic Acid Labeling Dye *Optimized for Labeling 100-300 ug DNA/RNA*

Sign In for Pricing
View Details
TESC (NM_017899) Human Recombinant Protein
TP322650 20 µg

TESC (NM_017899) Human Recombinant Protein

Sign In for Pricing
View Details
FKBP9 (NM_007270) Human Recombinant Protein
TP322307 20 µg

FKBP9 (NM_007270) Human Recombinant Protein

Sign In for Pricing
View Details