Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

P61383

Expression Region

1-117

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFDINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caffeidine
TRC-C080200-2.5G 2.5 g

Caffeidine

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (CIP1/2275R), CF405S conjugate, 0.1mg/mL
BNC042275-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (CIP1/2275R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
Oxamarin
TRC-O845085-1G 1 g

Oxamarin

Sign In for Pricing
View Details
SSB Rabbit Polyclonal Antibody
AP20317PU-N 100 µg

SSB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details