Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog (crcB)

This Recombinant Staphylococcus aureus Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q2FFV9

Expression Region

1-117

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vimentin (VM1170), CF555 conjugate, 0.1mg/mL
BNC551170-500 1x 500 µL

Vimentin (VM1170), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Gata3 activation kit by CRISPRa
GA201553 1 Kit

Mouse Gata3 activation kit by CRISPRa

Sign In for Pricing
View Details
PKC iota (PRKCI) Human Gene Knockout Kit (CRISPR)
KN205379LP 1 Kit

PKC iota (PRKCI) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAPSS1 (C-term) Rabbit Polyclonal Antibody
AP12297PU-N 400 µL

PAPSS1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fabp5 Polyclonal Antibody
E-AB-40646-01 25 µL

Fabp5 Polyclonal Antibody

Sign In for Pricing
View Details
Fabp5 Polyclonal Antibody
E-AB-40646-02 100 µL

Fabp5 Polyclonal Antibody

Sign In for Pricing
View Details