Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog (crcB)

This Recombinant Staphylococcus aureus Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q2FFV9

Expression Region

1-117

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin (Autophagy Marker) (UBB/1748), 1mg/mL
BNUM1748-50 1x 50 µL

Ubiquitin (Autophagy Marker) (UBB/1748), 1mg/mL

Sign In for Pricing
View Details
GFAP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]
TA500340BM 100 µL

GFAP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]

Sign In for Pricing
View Details
Biosafety Transport Box BTBT-103
BTBT-103 1 Unit

Biosafety Transport Box BTBT-103

Sign In for Pricing
View Details
Appl1 Mouse Gene Knockout Kit (CRISPR)
KN501444 1 Kit

Appl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Aminophenol-15N
TRC-A618924-2.5MG 2.5 mg

4-Aminophenol-15N

Sign In for Pricing
View Details
Mouse Chrna1 activation kit by CRISPRa
GA200031 1 Kit

Mouse Chrna1 activation kit by CRISPRa

Sign In for Pricing
View Details