Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q2FXE5

Expression Region

1-117

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZCCHC10 (10-14) Rabbit Polyclonal Antibody
AP26053PU-S 50 µL

ZCCHC10 (10-14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
9-Anthracenol Melitracen
TRC-A851290-100MG 100 mg

9-Anthracenol Melitracen

Sign In for Pricing
View Details
GNRH2 (NM_001501) Human Over-expression Lysate
LC419904 20 µg

GNRH2 (NM_001501) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Olig3 Antibody
RC-16467-01 50 μL

Recombinant Olig3 Antibody

Sign In for Pricing
View Details
Recombinant Olig3 Antibody
RC-16467-02 100 µL

Recombinant Olig3 Antibody

Sign In for Pricing
View Details
Recombinant Olig3 Antibody
RC-16467-03 1 mL

Recombinant Olig3 Antibody

Sign In for Pricing
View Details