Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q2FXE5

Expression Region

1-117

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TIMP-1 protein (His tag)
PDMH100115-01 20 µg

Recombinant Human TIMP-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TIMP-1 protein (His tag)
PDMH100115-02 100 µg

Recombinant Human TIMP-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TIMP-1 protein (His tag)
PDMH100115-03 500 µg

Recombinant Human TIMP-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TIMP-1 protein (His tag)
PDMH100115-04 1 mg

Recombinant Human TIMP-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Cathepsin B/CTSB Protein (His Tag)
PKSH032179-01 10 µg

Recombinant Human Cathepsin B/CTSB Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Cathepsin B/CTSB Protein (His Tag)
PKSH032179-02 50 µg

Recombinant Human Cathepsin B/CTSB Protein (His Tag)

Sign In for Pricing
View Details