Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q2YTK4

Expression Region

1-117

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL30P11 3'UTR GFP Stable Cell Line
TU071275 1.0 mL

RPL30P11 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NRSF (m) -PR
sc-38130-PR 10 µM - 20 µL

NRSF (m) -PR

Sign In for Pricing
View Details
TACSTD2
CSB-CL023072HU 10 μg Plasmid + 200 μL Glycerol

TACSTD2

Sign In for Pricing
View Details
Human MID2 Pre-designed siRNA Set A
SI009577A 1 Each

Human MID2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Meclofenamic acid sodium salt
GL0681-1g 1 g

Meclofenamic acid sodium salt

Sign In for Pricing
View Details
Research Grade Anti-Human FN1/Fibronectin (HuBC-1 ScFv)
MBS1580837-01 0.1 mg

Research Grade Anti-Human FN1/Fibronectin (HuBC-1 ScFv)

Sign In for Pricing
View Details