Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q2YTK4

Expression Region

1-117

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Muscle, Skeletal, Receptor Tyrosine Kinase (MUSK)
RPU42845-01 50 µg

Recombinant Mouse Muscle, Skeletal, Receptor Tyrosine Kinase (MUSK)

Sign In for Pricing
View Details
Recombinant Mouse Muscle, Skeletal, Receptor Tyrosine Kinase (MUSK)
RPU42845-02 100 µg

Recombinant Mouse Muscle, Skeletal, Receptor Tyrosine Kinase (MUSK)

Sign In for Pricing
View Details
Recombinant Mouse Muscle, Skeletal, Receptor Tyrosine Kinase (MUSK)
RPU42845-03 1 mg

Recombinant Mouse Muscle, Skeletal, Receptor Tyrosine Kinase (MUSK)

Sign In for Pricing
View Details
Ms4a6c CRISPRa sgRNA lentivector (set of three targets)(Mouse)
30714124 3x 1.0µg DNA

Ms4a6c CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Fish TGFb (Transforming Growth Factor Beta) ELISA Kit
MBS8807437-01 48 Well

Fish TGFb (Transforming Growth Factor Beta) ELISA Kit

Sign In for Pricing
View Details
Fish TGFb (Transforming Growth Factor Beta) ELISA Kit
MBS8807437-02 96 Well

Fish TGFb (Transforming Growth Factor Beta) ELISA Kit

Sign In for Pricing
View Details