Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q2YTK4

Expression Region

1-117

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABA A Receptor beta 1 Antibody
AF7751-01 50 µL

GABA A Receptor beta 1 Antibody

Sign In for Pricing
View Details
GABA A Receptor beta 1 Antibody
AF7751-02 100 µL

GABA A Receptor beta 1 Antibody

Sign In for Pricing
View Details
GABA A Receptor beta 1 Antibody
AF7751-03 200 µL

GABA A Receptor beta 1 Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human CLN6 (CLN6 transmembrane ER protein) Expressed in vitro E.coli expression system, Full Length
MPX3046K Each

Magic™ Membrane Protein Human CLN6 (CLN6 transmembrane ER protein) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Anti-Ep-Cam Monoclonal Antibody (Clone:IHC567) -Ready to Use
44-1144-7 7 mL

Anti-Ep-Cam Monoclonal Antibody (Clone:IHC567) -Ready to Use

Sign In for Pricing
View Details
PTGES Recombinant Protein (Rat)
RP222812 100 µg

PTGES Recombinant Protein (Rat)

Sign In for Pricing
View Details