Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q5HEZ2

Expression Region

1-117

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISTSW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 450 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102Q-01 50 Tests

Elab Fluor® Violet 450 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS703017 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
b-Nicotinamide Adenine Dinucleotide Sodium Salt Hydrate
TRC-N407775-1G 1 g

b-Nicotinamide Adenine Dinucleotide Sodium Salt Hydrate

Sign In for Pricing
View Details
Sdhaf4 (NM_026503) Mouse Tagged ORF Clone
MG200347 10 µg

Sdhaf4 (NM_026503) Mouse Tagged ORF Clone

Sign In for Pricing
View Details