Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q6G8E7

Expression Region

1-117

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAITRSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLNIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRRX1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E10]
TA803116AM 100 µL

PRRX1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E10]

Sign In for Pricing
View Details
1,4-Bis(2-cyanostyryl)benzene
TRC-B419890-50MG 50 mg

1,4-Bis(2-cyanostyryl)benzene

Sign In for Pricing
View Details
RPS3 Antibody
8C14118-AAT 50 µg

RPS3 Antibody

Sign In for Pricing
View Details
Benz[a]anthracene-7-acetonitrile
TRC-B183580-25MG 25 mg

Benz[a]anthracene-7-acetonitrile

Sign In for Pricing
View Details
CHRDL1 Human Gene Knockout Kit (CRISPR)
KN402635 1 Kit

CHRDL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS705214 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details