Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q6G8E7

Expression Region

1-117

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAITRSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLNIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spesp1 Mouse Gene Knockout Kit (CRISPR)
KN516594 1 Kit

Spesp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Helicobacter pylori (Rabbit PAb), CF488A conjugate, 0.1mg/mL
BNC880374-100 1x 100 µL

Helicobacter pylori (Rabbit PAb), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCF4 (Transcription Factor 4) (TCF4/1705), Biotin conjugate, 0.1mg/mL
BNCB1705-100 1x 100 µL

TCF4 (Transcription Factor 4) (TCF4/1705), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Genomic DNA, Spleen
CD565017 5 µg

Tissue Genomic DNA, Spleen

Sign In for Pricing
View Details
Ang2 Mouse Gene Knockout Kit (CRISPR)
KN501229 1 Kit

Ang2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Amino-2-hydroxybenzonitrile
TRC-A576885-1G 1 g

5-Amino-2-hydroxybenzonitrile

Sign In for Pricing
View Details