Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus epidermidis Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q8CS28

Expression Region

1-117

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITILLVMLGGGIGAVLRALITNICQRLFNSKIPIATSIVNITGSLIIGFMMGHALDSHH MFPFFVTGVLGGLTTFSTLSSELVNMLSPQFKPIRFVVYSLLQFILGFIACFYGYRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Aicda activation kit by CRISPRa
GA200136 1 Kit

Mouse Aicda activation kit by CRISPRa

Sign In for Pricing
View Details
TAF1 Recombinant Rabbit Monoclonal Antibody [JE40-02]
HA722747 100 µL

TAF1 Recombinant Rabbit Monoclonal Antibody [JE40-02]

Sign In for Pricing
View Details
CD23 (Fc Epsilon RII) (FCER2/3592), CF640R conjugate, 0.1mg/mL
BNC403592-500 1x 500 µL

CD23 (Fc Epsilon RII) (FCER2/3592), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACY3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H8]
TA502294BM 100 µL

ACY3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H8]

Sign In for Pricing
View Details
KRTAP10-1 Human qPCR Primer Pair (NM_198691)
HP219427 200 Reactions

KRTAP10-1 Human qPCR Primer Pair (NM_198691)

Sign In for Pricing
View Details
Recombinant STOML2 Antibody
RN-13690-01 50 μL

Recombinant STOML2 Antibody

Sign In for Pricing
View Details