Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus epidermidis Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q8CS28

Expression Region

1-117

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITILLVMLGGGIGAVLRALITNICQRLFNSKIPIATSIVNITGSLIIGFMMGHALDSHH MFPFFVTGVLGGLTTFSTLSSELVNMLSPQFKPIRFVVYSLLQFILGFIACFYGYRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5mL MacroTubes®
C2500-Y 200 Units/Pack

5mL MacroTubes®

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS709260 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Beta Catenin (p120) (Rabbit PAb), CF568 conjugate, 0.1mg/mL
BNC680376-100 1x 100 µL

Beta Catenin (p120) (Rabbit PAb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Purified Anti-Mouse CD210/IL-10R Antibody[1B1.3A]
E-AB-F1036A-01 25 µg

Purified Anti-Mouse CD210/IL-10R Antibody[1B1.3A]

Sign In for Pricing
View Details
Purified Anti-Mouse CD210/IL-10R Antibody[1B1.3A]
E-AB-F1036A-02 100 µg

Purified Anti-Mouse CD210/IL-10R Antibody[1B1.3A]

Sign In for Pricing
View Details
ZNF408 (NM_024741) Human Over-expression Lysate
LY403021 100 µg

ZNF408 (NM_024741) Human Over-expression Lysate

Sign In for Pricing
View Details