Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus epidermidis Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q8CS28

Expression Region

1-117

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITILLVMLGGGIGAVLRALITNICQRLFNSKIPIATSIVNITGSLIIGFMMGHALDSHH MFPFFVTGVLGGLTTFSTLSSELVNMLSPQFKPIRFVVYSLLQFILGFIACFYGYRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scanning UV Visible Spectrophotometer BSSNU-104
BSSNU-104 Each

Scanning UV Visible Spectrophotometer BSSNU-104

Sign In for Pricing
View Details
Ethyl Palmitoleate
TRC-E925855-1G 1 g

Ethyl Palmitoleate

Sign In for Pricing
View Details
FAM126A (NM_032581) Human Over-expression Lysate
LY403173 100 µg

FAM126A (NM_032581) Human Over-expression Lysate

Sign In for Pricing
View Details
GALK1 (C-term) Rabbit Polyclonal Antibody
AP13661PU-N 400 µL

GALK1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GTF2H4 Human Gene Knockout Kit (CRISPR)
KN402555 1 Kit

GTF2H4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/1762), 0.2mg/mL
BNUB1762-500 1x 500 µL

Bcl-X (Apoptosis Marker) (BCL2L1/1762), 0.2mg/mL

Sign In for Pricing
View Details