Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q8NW03

Expression Region

1-117

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAITRSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLNIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INO80 Rabbit Polyclonal Antibody
TA372777 100 µL

INO80 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Ɑ-Hydroxy-ω-Pam₃Cys PEG
135000-00-8.5MG 5 mg

Ɑ-Hydroxy-ω-Pam₃Cys PEG

Sign In for Pricing
View Details
CORO2A Rabbit Polyclonal Antibody
TA365888 100 µL

CORO2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details