Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q8NW03

Expression Region

1-117

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAITRSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLNIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM116A (DENND6A) activation kit by CRISPRa
GA116402 1 Kit

Human FAM116A (DENND6A) activation kit by CRISPRa

Sign In for Pricing
View Details
Human ANKS1A activation kit by CRISPRa
GA108196 1 Kit

Human ANKS1A activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR559095 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
RAB32 Human Gene Knockout Kit (CRISPR)
KN203094LP 1 Kit

RAB32 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tezacaftor Metabolite M1
TRC-T254370-100MG 100 mg

Tezacaftor Metabolite M1

Sign In for Pricing
View Details
2-Bromo-4-nitrobenzoic Acid
TRC-B686215-25G 25 g

2-Bromo-4-nitrobenzoic Acid

Sign In for Pricing
View Details