Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q8NW03

Expression Region

1-117

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAITRSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLNIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (C3e/3171R), CF568 conjugate, 0.1mg/mL
BNC683171-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/3171R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APOBEC1 (NM_001644) Human Over-expression Lysate
LY400620 100 µg

APOBEC1 (NM_001644) Human Over-expression Lysate

Sign In for Pricing
View Details
SPR1 Antibody
8C11103-AAT 50 µg

SPR1 Antibody

Sign In for Pricing
View Details
Benzyl 2,2,2-Trichloroacetimidate
TRC-B316075-10G 10 g

Benzyl 2,2,2-Trichloroacetimidate

Sign In for Pricing
View Details
TRIM17 (NM_001024940) Human Over-expression Lysate
LC422560 20 µg

TRIM17 (NM_001024940) Human Over-expression Lysate

Sign In for Pricing
View Details
OptiWell™ Sealing Mats for DW Plates
D3320-13S 50 Units/Pack

OptiWell™ Sealing Mats for DW Plates

Sign In for Pricing
View Details