Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multidrug resistance protein EbrB (ebrB)

This Recombinant Multidrug resistance protein EbrB (ebrB) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Multidrug resistance protein EbrB

UniProt

P0CW83

Expression Region

1-117

Origin

Bacillus atrophaeus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGLLYLALAIVSEVFGSTMLKLSEGFTQAWPIGGVIAGFLSAFTFLSFSLKTIDLSSAY ATWSGVGTALTAIVGFLLFGETISLKGVFGLTLVIAGVVVLNQSKAPAKEKKQTVCE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1564053 sgRNA CRISPR Lentivector set (Rat)
K6331501 3x 1.0 µg

RGD1564053 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
ULK2 (unc-51-like Kinase 2 (C. elegans), KIAA0623, Unc51.2) (MaxLight 650)
253272-ML650 100 µL

ULK2 (unc-51-like Kinase 2 (C. elegans), KIAA0623, Unc51.2) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Monoclonal HAP1 Antibody (1B6) [Alexa Fluor 532]
NB110-74569AF532 0.1 mL

Mouse Monoclonal HAP1 Antibody (1B6) [Alexa Fluor 532]

Sign In for Pricing
View Details
PRRG1 (NM_001173490) Human Tagged Lenti ORF Clone
RC229709L4 10 µg

PRRG1 (NM_001173490) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FITC Anti-Mouse CD11a Antibody
MBS4514876-01 0.025 mg

FITC Anti-Mouse CD11a Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD11a Antibody
MBS4514876-02 0.05 mg

FITC Anti-Mouse CD11a Antibody

Sign In for Pricing
View Details