Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein ynzK (ynzK)

This Recombinant Uncharacterized membrane protein ynzK (ynzK) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ynzK

UniProt

C0H417

Expression Region

1-118

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYRNIVFYLILLCLFISVVMKSFEVIRTIANVICFIFVLLYFKDEMKTYSRKALAILSIC FLFLVGICAFIILQGQTLMKRHLFFTGLETIAGILLIIVSLSICTFILRKISNRLKRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sod3 (BC010975) Mouse Untagged Clone
MC206276 10 µg

Sod3 (BC010975) Mouse Untagged Clone

Sign In for Pricing
View Details
β-Dimorphecolic acid
HY-W744666 1 Each

β-Dimorphecolic acid

Sign In for Pricing
View Details
Recombinant Human ZNF563 Protein - (Dry Ice)
H00147837-P01-25ug 25 µg

Recombinant Human ZNF563 Protein - (Dry Ice)

Sign In for Pricing
View Details
3-Amino-5-cyano-benzoic acid methyl ester
ZHA53601 10 g

3-Amino-5-cyano-benzoic acid methyl ester

Sign In for Pricing
View Details
ASCL1 (G-7) Alexa Fluor® 790
sc-390794 AF790 200 µg/mL

ASCL1 (G-7) Alexa Fluor® 790

Sign In for Pricing
View Details
Factor B Mouse mAb, capture
orb2707611 100 µg

Factor B Mouse mAb, capture

Sign In for Pricing
View Details